PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01255.1.g00040.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 558aa    MW: 62230.9 Da    PI: 9.5382
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01255.1.g00040.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF36.56.4e-12510553750
                                     HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                          SRF-TF   7 snrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                                     ++ qv fsk r g++KK +E+  L daeva+++f   gkly y 
  Zpz_sc01255.1.g00040.1.sm.mkhc 510 RRSQVHFSKHRVGLFKKTFEVTLLYDAEVALVVFYACGKLYKYF 553
                                     6889*************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF827085.3E-2359186IPR001374R3H domain
SMARTSM003930.003365149IPR001374R3H domain
CDDcd026423.76E-1680149No hitNo description
PROSITE profilePS5106110.62781150IPR001374R3H domain
PfamPF014241.1E-883131IPR001374R3H domain
Gene3DG3DSA:3.30.1370.505.5E-1084131IPR001374R3H domain
PROSITE profilePS5167311.599154226IPR024771SUZ domain
PfamPF127521.9E-12177226IPR024771SUZ domain
SMARTSM004322.0E-4475555IPR002100Transcription factor, MADS-box
PfamPF003195.6E-11510552IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.19E-11511556IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.46511556IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-8518533IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-8533554IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MEPADADAAP APDSWETADI DGSMSRLILS PRRASSSPDL ADDQDQPPAQ QQAPSALAPR  60
EDSVAQVDQF LREALEKPRE RLSVLRMEQD ILKFIHDPRQ TQFEFTGLPT SYLRLAAHRL  120
AQHYFLQSIA IPDNSLPDGT GSRIILHKTS SECQLPAVRL ADIPVNLLQE EINSVAKVAI  180
KQRPQKNLHS MNISSAHSSR DSLQKSVEER KEEYNKARAR IFNNSSSNSS ADGRPVDEVA  240
LPNTLHRSTS LELNSSNRLG QGSEVTLERS LTTASASSRS NRNRTEKEPT VSRNRQNNRV  300
AIFRDRESER KDPDYDRSCD RYMQRFDPGF GFNRGPYTIQ PLYAPAVTYN TEFPQLGSAH  360
RSPVAVEQRP RSIAQHIPGT WSAAQAPNAI GYGPPDGGLA TYNPGQAGAP VRSPVFMHAS  420
QQYAMPTRPG VPFVHPQEPM RPFTQIKMPA GHFFLAYSLE GLCSQRTTFD GDEKIGMVHA  480
KNRQDVLKFG PALRPRRCPA SVPPLALAAR RSQVHFSKHR VGLFKKTFEV TLLYDAEVAL  540
VVFYACGKLY KYFSTRFA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956209.20.0PREDICTED: cAMP-regulated phosphoprotein 21-like
TrEMBLK4A0E70.0K4A0E7_SETIT; Uncharacterized protein
STRINGSb02g011970.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP756333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24540.14e-10AGAMOUS-like 24